PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011098917.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family TCP
Protein Properties Length: 309aa    MW: 32873.4 Da    PI: 9.0581
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011098917.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP126.33.1e-3959144388
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                     +k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as+  a+  s s++ ss++
  XP_011098917.1  59 PKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASALAAAGGSISQQGSSIS 144
                     799*****************************************************************888555555555544444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.5E-3163301IPR005333Transcription factor, TCP
PROSITE profilePS5136928.01664118IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDPKNSKQPQ EVPSFLSLPQ SSSPTNHNNN AGQNKPAEVK DFQIVIAEKE EPKKQALQPK  60
RSSNKDRHTK VEGRGRRIRM PALCAARIFQ LTRELGHKSD GETIQWLLQQ AEPSIIAATG  120
TGTIPASALA AAGGSISQQG SSISSGLHQK IDDFHMGGGG SGSRSPWPLV GGNLGRPHVG  180
ANAGLWPPAA GVSGFGYQSS SSSSSGPSLG TESSNYLQKM GFPGFDLPTG NMGPMSFTSI  240
LGANSQQLPG LELGLSQDGS IGVLNPQAFN QIYQQIEQAR LMHQQHQHQN QHQQQQPQSS  300
KDDSQESGL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011098917.10.0PREDICTED: transcription factor TCP20
SwissprotQ9LSD51e-81TCP20_ARATH; Transcription factor TCP20
TrEMBLV7CWP01e-135V7CWP0_PHAVU; Uncharacterized protein
STRINGVIT_14s0068g01690.t011e-134(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.12e-69TCP family protein